RK22_WHEAT The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome (By similarity). rpl22 This protein binds specifically to 23S rRNA (By similarity). 50S ribosomal protein L22, chloroplastic MTSFKLVKYIPRIKKKKSGLRKLARKVPTDRLLKFERVFKAQKRIPMSVFKAQRVLDEIRWRYYEETVMILNLMPYRASYPILKLVYSAAANATHYRDFDKANLFITKAEVSRSTIMKKFRPRARGRSFPIKKSMCHITIVLNIVKKS 148